PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 470177
Common NameARALYDRAFT_470177
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 640aa    MW: 69772.5 Da    PI: 6.8628
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
470177genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.39.5e-152468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT +E+e++++a +++G   W +I +++  ++t+ q++s+ qk+
           470177 24 RERWTDDEHERFLEALRLYGRA-WQRIEEHIV-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-151874IPR009057Homeodomain-like
PROSITE profilePS5129419.0411973IPR017930Myb domain
TIGRFAMsTIGR015572.4E-172271IPR006447Myb domain, plants
SMARTSM007174.2E-112371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-82464IPR009057Homeodomain-like
PfamPF002491.2E-112467IPR001005SANT/Myb domain
CDDcd001674.53E-82669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 640 aa     Download sequence    Send to blast
MDTNISGEEL LAKARKPYTI TKQRERWTDD EHERFLEALR LYGRAWQRIE EHIVTKTAVQ  60
IRSHAQKFFT KLEKEAEAKG IPVCQALDIE IPPPRPKRKP NTPYPRKHGN NGTSSSQVSS  120
AKDAKLASSA SSSQFNQSFL DLEKMPFSEK TSTGKENQDD NCSDVSTVNK YPLPKKKVSG  180
DIETSKTSTV DNAVQDAPKK NKHKDGNDGT VYSVQNYLWH SHAGIVNGNI AKCPQNHPLG  240
MVSQDFMFHP MREESHGHAN LQATTASATA SHQAFPACHS QNDYHSFLQM SSTFSNLIMS  300
NLLQNPAAHA AATFAASVWP YANVGNSGDS STPVSSSPPS IAAIAAATVA AATAWWASHG  360
LLPVCAPAPI TCVPLPTPAM TEMGTVENAQ LPLEKQNTAL QDQNVASKSL ASSSDDSEET  420
GVTKLNVDSK TQGDKVGEVV AAAAVHDSNT TQKKNMVDRS SCGSNTPSGS DAETDALDKM  480
EKDKEDVKET DENQPDVIEL NNRKIKMRDN NNNNNNPTTD SWKEVSEEGR IAFQALFARE  540
KLPQSFSLPQ VAENVNGKQR DTAMPLVPNF KSQDSCAADQ ERVVMIGVGP GKNLKTRQTG  600
FKPYKRCSME LKESQVGNTN NQSDEKVCKR LRLEGEAST*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0064040.0AJ006404.1 Arabidopsis thaliana mRNA for LATE ELONGATED HYPOCOTYL MYB transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002889388.10.0hypothetical protein ARALYDRAFT_470177
SwissprotQ6R0H10.0LHY_ARATH; Protein LHY
TrEMBLD7KQB80.0D7KQB8_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.1__131__AT1G01060.30.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55762645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.30.0MYB_related family protein